PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.006G077800.1
Common NamePHAVU_006G077800g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family M-type_MADS
Protein Properties Length: 191aa    MW: 21840.9 Da    PI: 10.0924
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.006G077800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF473.2e-151151343
                        --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
              SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                        i +  +r+ tf kR+ng++KK +E+ vLC+++++ +++s++
  Phvul.006G077800.1 11 ITDPGKRKATFKKRKNGLMKKISEITVLCGIDACAVVYSPD 51
                        5666789********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006617.241149IPR002100Transcription factor, MADS-box
SMARTSM004322.6E-18161IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.19E-23296IPR002100Transcription factor, MADS-box
CDDcd002663.15E-27284No hitNo description
PRINTSPR004042.0E-8323IPR002100Transcription factor, MADS-box
PfamPF003191.4E-161151IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-82338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MTRAKIELAY ITDPGKRKAT FKKRKNGLMK KISEITVLCG IDACAVVYSP DVPNKPEFWP  60
SESGARSVIS KFNGVSESEK TKKMFCQESF IRQRIDKSQE QLKKLKNENR KREISLLMCE  120
YLTHGSNNLD SNNINYLKDF SFFTDQNLDE IRNKVTVHPA QEETPVIYSR GEQAQAQGHG  180
TNFSRKRKLN *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150381e-142AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007146876.11e-141hypothetical protein PHAVU_006G077800g
TrEMBLV7BP901e-141V7BP90_PHAVU; Uncharacterized protein
STRINGGLYMA03G19880.13e-66(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF4044422
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65300.13e-36AGAMOUS-like 38